PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr008318.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family S1Fa-like
Protein Properties Length: 77aa    MW: 8389.11 Da    PI: 10.608
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr008318.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA127.54.1e-401376770
         S1FA  7 eakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                 +akG+nPGlivl+vv glll+flvgny+lyvyaq++lPP+kkkPvskkklk+e+lkqGv++PGe
  Pbr008318.1 13 DAKGFNPGLIVLIVVVGLLLLFLVGNYALYVYAQRTLPPKKKKPVSKKKLKKERLKQGVSAPGE 76
                 79*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046894.3E-391376IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MADQFEDKVP PPDAKGFNPG LIVLIVVVGL LLLFLVGNYA LYVYAQRTLP PKKKKPVSKK  60
KLKKERLKQG VSAPGE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009342653.18e-47PREDICTED: DNA-binding protein S1FA-like
SwissprotQ7XLX62e-20S1FA2_ORYSJ; DNA-binding protein S1FA2
TrEMBLW9SCA36e-27W9SCA3_9R
STRINGBGIOSGA015143-PA5e-18(Oryza sativa Indica Group)
STRINGLOC_Os04g33440.25e-18(Oryza sativa Japonica Group)
STRINGSolyc09g007500.2.17e-18(Solanum lycopersicum)
STRINGORGLA04G0086600.15e-18(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3834122